DISPLAY QMGR (display queue manager settings)

Use the MQSC command DISPLAY QMGR to display the queue manager parameters for this queue manager.

Using MQSC commands

For information on how you use MQSC commands, see Administering IBM® MQ using MQSC commands.

Syntax diagram for DISPLAY QMGR

Synonym: DIS QMGR

DISPLAY QMGR

Read syntax diagramSkip visual syntax diagram DISPLAY QMGR ALL CMDSCOPE(' ')CMDSCOPE(qmgr-name)1CMDSCOPE(*)12,SYSTEMEVENTCHINITCLUSTERPUBSUBqueue manager system attributesevent control attributesdistributed queuing attributescluster attributesqueue manager publish/subscribe attributes
Queue manager system attributes
Read syntax diagramSkip visual syntax diagram,ACCTCONO3ACCTINT3ACCTMQI3ACCTQACTIVRECACTVCONO3ACTVTRC3ADVCAPALTDATEAMQPCAP3ALTTIMECCSIDCFCONLOS2CMDLEVELCOMMANDQCONNAUTHCPILEVEL2CRDATE3CRTIME3CUSTOMDEADQDESCRDISTL3EXPRYINT2GROUPUR2IMGINTVL3IMGLOGLN3IMGRCOVO3IMGRCOVQ3IMGSCHED3INITKEY3MARKINTMAXHANDSMAXMSGLMAXPROPLMAXPRTYMAXUMSGSMONQOTELPCTL2OTELTRAC2PLATFORMQMNAMEQSGNAME2ROUTERECSCMDSERV3SCYCASE2SPLCAPSQQMNAME2STATINT3STATMQI3STATQSYNCPTTRIGINTVERSIONXRCAP
Event control attributes
Read syntax diagramSkip visual syntax diagram,AUTHOREVAUTHEVSC3BRIDGEEV2CHLEVCMDEVCONFIGEVINHIBTEVLOCALEVLOGGEREV3PERFMEVREMOTEEVSSLEVSTRSTPEV
Distributed queuing attributes for z/OS
Read syntax diagramSkip visual syntax diagram,ACTCHLADOPTCHKADOPTMCACERTLABLCERTQSGLCHADEXITCHIADAPSCHIDISPSCHISERVPCHLAUTHCHLEVDEADQDEFXMITQDNSGROUPDNSWLMIGQIGQAUTIGQUSERIPADDRVLSTRTMRLUGROUPLUNAMELU62ARMLU62CHLMAXCHLMONACLSMONCHLOPORTMAXOPORTMINQMIDRCVTIMERCVTMINRCVTTYPEREVDNSSSLCRLNLSSLEVSSLFIPSSSLKEYRSSLRKEYCSSLTASKSSTATACLSSTATCHLTCPCHLTCPKEEPTCPNAMETCPSTACKTRAXSTRTRAXTBL
Distributed queuing attributes for other platforms
Read syntax diagramSkip visual syntax diagram,CERTVPOL4CHAD3CHADEV3CHADEXITCERTLABLCHLEVCHLAUTHDEADQDEFXMITQIPADDRVKEYRPWD5MONCHLQMIDREVDNSSCHINIT3SSLCRLNLSSLCRYP5SSLEVSSLFIPS4SSLKEYRSSLRKEYCSTATCHLSUITEB5
Cluster attributes
Read syntax diagramSkip visual syntax diagram,CHADEXITCLWLDATACLWLEXITCLWLLENCLWLMRUCCLWLUSEQDEFCLXQMONACLSPSCLUSQMIDREPOSREPOSNLSTATACLS
Queue manager publish/subscribe attributes
Read syntax diagramSkip visual syntax diagram,PARENTPSCLUSPSMODEPSNPMSGPSNPRESPSRTYCNTPSSYNCPTTREELIFE
Notes:
  • 1 Valid only on z/OS when the queue manager is a member of a queue sharing group.
  • 2 Valid only on z/OS.
  • 3 Not valid on z/OS.
  • 4 Not valid on IBM i.
  • 5 Valid only on AIX®, Linux®, and Windows.

Parameter descriptions for DISPLAY QMGR

ALL
Specify this parameter to display all the parameters. If this parameter is specified, any parameters that are requested specifically are ineffective; all parameters are still displayed.

[UNIX, Linux, Windows, IBM i]On Multiplatforms, this parameter is the default if you do not request any specific parameters.

[z/OS]CMDSCOPE
This parameter applies to z/OS only and specifies how the command runs when the queue manager is a member of a queue sharing group.
' '
The command runs on the queue manager on which it was entered. This command is the default value.
qmgr-name
The command runs on the queue manager you specify, providing the queue manager is active within the queue sharing group.

You can specify a queue manager name, other than the queue manager on which the command was entered, only if you are using a queue sharing group environment and if the command server is enabled.

*
The command runs on the local queue manager and is also passed to every active queue manager in the queue sharing group. The effect of running this command is the same as entering the command on every queue manager in the queue sharing group.
SYSTEM
Specify this parameter to display the set of queue manager system attributes that are available in the Queue manager system attrs list. See Requested parameters for information about these parameters.

If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

EVENT
Specify this parameter to display the set of event control attributes that are available in the Event control attrs list. See Requested parameters for information about these parameters.

If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

CHINIT
Specify this parameter to display the set of attributes relating to distributed queuing that are available in the Distributed queuing attrs list. You can also specify DQM to display the same set of attributes. See Requested parameters for information about these parameters.

If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

CLUSTER
Specify this parameter to display the set of attributes relating to clustering that are available in the Cluster attrs list. See Requested parameters for information about these parameters.

If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

PUBSUB
Specify this parameter to display the set of attributes relating to publish/subscribe that are available in the Queue manager pub/sub attrs list. See Requested parameters for information about these parameters.

If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

Requested parameters

Note: If no parameters are specified (and the ALL parameter is not specified or defaulted), the queue manager name is returned.
You can request the following information for the queue manager:
[UNIX, Linux, Windows, IBM i]ACCTCONO
Whether the settings of the ACCTQMQI and ACCTQ queue manager parameters can be overridden. This parameter is valid only on Multiplatforms.
[UNIX, Linux, Windows, IBM i]ACCTINT
The interval at which intermediate accounting records are written. This parameter is valid only on Multiplatforms.
[UNIX, Linux, Windows, IBM i]ACCTMQI
Whether accounting information is to be collected for MQI data. This parameter is valid only on Multiplatforms.
ACCTQ
Whether accounting data collection is to be enabled for queues.
[z/OS]ACTCHL
The maximum number of channels that can be active at any time.

This parameter is valid only on z/OS.

ACTIVREC
Whether activity reports are to be generated if requested in the message.
[UNIX, Linux, Windows, IBM i]ACTVCONO
Whether the settings of the ACTVTRC queue manager parameter can be overridden. This parameter is valid only on Multiplatforms.
[UNIX, Linux, Windows, IBM i]ACTVTRC
Whether IBM MQ MQI application activity tracing information is to be collected. See Setting ACTVTRC to control collection of activity trace information. This parameter is valid only on Multiplatforms.
[z/OS]ADOPTCHK
Which elements are checked to determine whether an MCA is adopted when a new inbound channel is detected with the same name as an already active MCA.

This parameter is valid only on z/OS.

[z/OS]ADOPTMCA
Whether an orphaned MCA instance is to be restarted when a new inbound channel request matching the ADOPTCHK parameters is detected.

This parameter is valid only on z/OS.

[IBM MQ Advanced]ADVCAP
Whether IBM MQ Advanced extended capabilities are available for a queue manager.

[z/OS]On z/OS, the queue manager sets the value to be ENABLED, only if the value of QMGRPROD is ADVANCEDVUE. For any other value of QMGRPROD, or if QMGRPROD is not set, the queue manager sets the value to DISABLED. If ADVCAP is ENABLED you must be entitled to IBM MQ Advanced for z/OS Value Unit Edition (VUE). See START QMGR (start queue manager) on z/OS and Installing IBM MQ Advanced for z/OS Value Unit Edition for more information.

[UNIX, Linux, Windows, IBM i]On other platforms, the queue manager sets the value to be ENABLED, only if you have installed Managed File Transfer, XR, Advanced Message Security or RDQM. If you have not installed Managed File Transfer, XR, Advanced Message Security or RDQM, ADVCAP is set to DISABLED. If ADVCAP is ENABLED, you must be entitled to IBM MQ Advanced. The list of installable components that enable ADVCAP might change in future releases. for more information, see IBM MQ components and features and Installing IBM MQ Advanced for Multiplatforms.

ALTDATE
The date on which the definition was last altered, in the form yyyy-mm-dd.
ALTTIME
The time at which the definition was last altered, in the form hh.mm.ss.
AMQPCAP
Whether AMQP capabilities are available for a queue manager.
AUTHOREV
Whether authorization events are generated.
[MQ 9.4.3 Jun 2025][UNIX, Linux, Windows, IBM i]AUTHEVSC
The scope of authorization events generated when authorization events are enabled.
This parameter is valid on Multiplatforms only.
[z/OS]BRIDGEEV
On z/OS only, whether IMS bridge events are generated.
CCSID
Coded character set identifier. This parameter applies to all character string fields defined by the application programming interface (API), including the names of objects, and the creation date and time of each queue. It does not apply to application data carried as the text of messages.
CERTLABL
Specifies the certificate label that this queue manager used.
[z/OS]CERTQSGL
Specifies the queue sharing group (QSG) certificate label.

This parameter is valid only on z/OS.

[AIX, Linux, Windows]CERTVPOL
Specifies which TLS certificate validation policy is used to validate digital certificates received from remote partner systems. This attribute can be used to control how strictly the certificate chain validation conforms to industry security standards. For more information about certificate validation policies, see Certificate validation policies in IBM MQ.

This parameter is valid only on AIX, Linux, and Windows.

[z/OS]CFCONLOS
Specifies the action to be taken when the queue manager loses connectivity to the administration structure, or any CF structure with CFCONLOS set to ASQMGR.

This parameter is valid only on z/OS.

[UNIX, Linux, Windows, IBM i]CHAD
Whether auto-definition of receiver and server-connection channels is enabled.
[z/OS]This parameter is not valid on z/OS.
[UNIX, Linux, Windows, IBM i]CHADEV
Whether auto-definition events are enabled.
[z/OS]This parameter is not valid on z/OS.
CHADEXIT
The name of the channel auto-definition exit.
[z/OS]CHIADAPS
The number of adapter subtasks to use to process IBM MQ calls.

This parameter is valid only on z/OS.

[z/OS]CHIDISPS
The number of dispatchers to use for the channel initiator.

This parameter is valid only on z/OS.

CHISERVP
This field is reserved for IBM use only.
CHLAUTH
Whether channel authentication records are checked.
CHLEV
Whether channel events are generated.
CLWLEXIT
The name of the cluster workload exit.
CLWLDATA
The data passed to the cluster workload exit.
CLWLLEN
The maximum number of bytes of message data that is passed to the cluster workload exit.
CLWLMRUC
The maximum number of outbound cluster channels.
CLWLUSEQ
The behavior of MQPUTs for queues where CLWLUSEQ has a value of QMGR.
CMDEV
Whether command events are generated.
CMDLEVEL
Command level. This indicates the level of system control commands supported by the queue manager.
COMMANDQ
The name of the system-command input queue. Suitably authorized applications can put commands on this queue.
CONFIGEV
Whether configuration events are generated.
CONNAUTH
The name of an authentication information object that is used to provide the location of user ID and password authentication.
CPILEVEL
Reserved, this value has no significance.
CRDATE
The date on which the queue manager was created (in the form yyyy-mm-dd).
CRTIME
The time at which the queue manager was created (in the form hh.mm.ss).
CUSTOM
This attribute is reserved for the configuration of new features before separate attributes have been introduced. It can contain the values of zero or more attributes as pairs of attribute name and value in the form NAME(VALUE).
DEADQ
The name of the queue to which messages are sent if they cannot be routed to their correct destination (the dead-letter queue or undelivered-message queue). The default is blanks.
For example, messages are put on this queue when:
  • A message arrives at a queue manager, destined for a queue that is not yet defined on that queue manager
  • A message arrives at a queue manager, but the queue for which it is destined cannot receive it because, possibly:
    • The queue is full
    • The queue is inhibited for puts
    • The sending node does not have authority to put the message on the queue
  • An exception message must be generated, but the queue named is not known to that queue manager
Note: Messages that have passed their expiry time are not transferred to this queue when they are discarded.

If the dead-letter queue is not defined, or full, or unusable for some other reason, a message that would have been transferred to it by a message channel agent is retained instead on the transmission queue.

If a dead-letter queue or undelivered-message queue is not specified, all blanks are returned for this parameter.

DEFCLXQ
The DEFCLXQ attribute controls which transmission queue is selected by default by cluster-sender channels to get messages from, to send the messages to cluster-receiver channels.
SCTQ

All cluster-sender channels send messages from SYSTEM.CLUSTER.TRANSMIT.QUEUE. The correlID of messages placed on the transmission queue identifies which cluster-sender channel the message is destined for.

SCTQ is set when a queue manager is defined. DEFCLXQ was not present.

CHANNEL
Each cluster-sender channel sends messages from a different transmission queue. Each transmission queue is created as a permanent dynamic queue from the model queue SYSTEM.CLUSTER.TRANSMIT.MODEL.QUEUE.

If the queue manager attribute, DEFCLXQ, is set to CHANNEL,the default configuration is changed to cluster-sender channels being associated with individual cluster transmission queues. The transmission queues are permanent-dynamic queues created from the model queue SYSTEM.CLUSTER.TRANSMIT.MODEL.QUEUE. Each transmission queue is associated with one cluster-sender channel. As one cluster-sender channel services a cluster transmission queue, the transmission queue contains messages for only one queue manager in one cluster. You can configure clusters so that each queue manager in a cluster contains only one cluster queue. In this case, the message traffic from a queue manager to each cluster queue is transferred separately from messages to other queues.

DEFXMITQ
Default transmission queue name. This parameter is the transmission queue on which messages, destined for a remote queue manager, are put if there is no other suitable transmission queue defined.
DESCR
Description.
[UNIX, Linux, Windows, IBM i]DISTL
Whether distribution lists are supported by the queue manager.
[z/OS]This parameter is not valid on z/OS.
[z/OS]DNSGROUP
This parameter is no longer used. See z/OS: WLM/DNS no longer supported. This parameter is valid only on z/OS
[z/OS]DNSWLM
This parameter is no longer used. See z/OS: WLM/DNS no longer supported. This parameter is valid only on z/OS.
[z/OS]EXPRYINT
On z/OS only, the approximate interval between scans for expired messages.
[z/OS]GROUPUR
On z/OS only, whether XA client applications are allowed to connect to this queue manager with a GROUP unit of recovery disposition.
IMGINTVL
The target frequency with which the queue manager automatically writes media images.
[z/OS]This parameter is not valid on z/OS.
IMGLOGLN
The target amount of recovery log written by which the queue manager automatically writes media images.
[z/OS]This parameter is not valid on z/OS.
IMGRCOVO
Whether specified objects are recoverable from a media image, if linear logging is being used.
[z/OS]This parameter is not valid on z/OS.
IMGRCOVQ
Whether a local or permanent dynamic queue object is recoverable from a media image, if linear logging is being used.
[z/OS]This parameter is not valid on z/OS.
IMGSCHED
Whether the queue manager automatically writes media images.
[z/OS]This parameter is not valid on z/OS.
[z/OS]IGQ
On z/OS only, whether intra-group queuing is to be used.
[z/OS]IGQAUT
On z/OS only, displays the type of authority checking used by the intra-group queuing agent.
[z/OS]IGQUSER
On z/OS only, displays the user ID used by the intra-group queuing agent.
INHIBTEV
Whether inhibit events are generated.
[UNIX, Linux, Windows, IBM i]INITKEY
Initial key for the password protection system.  The value appears as ******** when set to a custom value. The value appears as ' ' when the default key is in use.
[z/OS]This parameter is not valid on z/OS.
IPADDRV
Whether to use an IPv4 or IPv6 IP address for a channel connection in ambiguous cases.
[AIX, Linux, Windows]KEYRPWD
The password for the TLS key repository.  The value appears as ********.
This parameter is valid only on AIX, Linux, and Windows.
LOCALEV
Whether local error events are generated.
[UNIX, Linux, Windows, IBM i]LOGGEREV
Whether recovery log events are generated. This parameter is valid only on Multiplatforms.
[z/OS]LSTRTMR
The time interval, in seconds, between attempts by IBM MQ to restart the listener after an APPC or TCP/IP failure.

This parameter is valid only on z/OS.

[z/OS]LUGROUP
The generic LU name to be used by the LU 6.2 listener that handles inbound transmissions for the queue sharing group.

This parameter is valid only on z/OS.

[z/OS]LUNAME
The name of the LU to use for outbound LU 6.2 transmissions.

This parameter is valid only on z/OS.

[z/OS]LU62ARM
The suffix of the APPCPM member of SYS1.PARMLIB. This suffix nominates the LUADD for this channel initiator. When automatic restart manager (ARM) restarts the channel initiator, the z/OS command SET APPC= xx is issued.

This parameter is valid only on z/OS.

[z/OS]LU62CHL
The maximum number of channels that can be current, or clients that can be connected, that use the LU 6.2 transmission protocol. If the value of LU62CHL is zero, the LU 6.2 transmission protocol is not used.

This parameter is valid only on z/OS.

MARKINT
The mark browse interval in milliseconds.
Attention: This value should not be below the default of 5000.
[z/OS]MAXCHL
The maximum number of channels that can be current (including server-connection channels with connected clients).

This parameter is valid only on z/OS.

MAXHANDS
The maximum number of open handles that any one connection can have at any one time.
MAXMSGL
The maximum message length that can be handled by the queue manager. Individual queues or channels might have a smaller maximum than the value of this parameter.
MAXPROPL ( integer )
The maximum length of property data in bytes that can be associated with a message.
MAXPRTY
The maximum priority. This value is 9.
MAXUMSGS
Maximum number of uncommitted messages within one sync point. The default value is 10000.

MAXUMSGS has no effect on MQ Telemetry. MQ Telemetry tries to batch requests to subscribe, unsubscribe, send, and receive messages from multiple clients into batches of work within a transaction.

MONACLS
Whether online monitoring data is to be collected for auto-defined cluster-sender channels, and, if so, the rate of data collection.
MONCHL
Whether online monitoring data is to be collected for channels, and, if so, the rate of data collection.
MONQ
Whether online monitoring data is to be collected for queues, and, if so, the rate of data collection.
[z/OS]OPORTMAX
The maximum value in the range of port numbers to be used when binding outgoing channels.

This parameter is valid only on z/OS.

[z/OS]OPORTMIN
The minimum value in the range of port numbers to be used when binding outgoing channels.

This parameter is valid only on z/OS.

[MQ 9.4.3 Jun 2025][z/OS]OTELPCTL
Whether the queue manager automatically propagates trace context from the application environment to the message on MQPUT, or from the message to the environment on MQGET. [MQ 9.4.5 Feb 2026]For IMS bridge queues, also controls whether the IMS bridge automatically propagates trace context from the messages it gets to IMS.

The OTELPCTL value on individual queues might override this value.

For more information on automatic propagation, see Trace propagation.

This parameter is valid only on z/OS.

[MQ 9.4.3 Jun 2025][z/OS]OTELTRAC
Whether the queue manager emits spans as messages are sent to or consumed from queues. [MQ 9.4.5 Feb 2026]For IMS bridge queues, also controls whether the IMS bridge emits spans when it sends the messages it gets to IMS.

The OTELTRAC value on individual queues might override this value, unless NONE is specified.

For more information on span emission, see Span emission.

This parameter is valid only on z/OS.

PARENT
The name of the queue manager to which this queue manager is connected hierarchically as its child.
PERFMEV
Whether performance-related events are generated.
PLATFORM
The architecture of the platform on which the queue manager is running. The value of this parameter is:
  • [z/OS]MVS (for z/OS platforms)
  • NSK
  • OS2
  • OS400
  • APPLIANCE
  • UNIX
  • WINDOWSNT
PSCLUS
Controls whether this queue manager participates in publish subscribe activity across any clusters in which it is a member. No clustered topic objects can exist in any cluster when modifying from ENABLED to DISABLED.
PSMODE
Controls whether the publish/subscribe engine and the queued publish/subscribe interface are running, and therefore controls whether applications can publish or subscribe by using the application programming interface and the queues that are monitored by the queued publish/subscribe interface.
PSNPMSG
If the queued publish/subscribe interface cannot process a non-persistent input message it might attempt to write the input message to the dead-letter queue (depending on the report options of the input message). If the attempt to write the input message to the dead-letter queue fails, and the MQRO_DISCARD_MSG report option was specified on the input message or PSNPMSG=DISCARD, the broker discards the input message. If PSNPMSG=KEEP is specified, the interface only discards the input message if the MQRO_DISCARD_MSG report option was set in the input message.
PSNPRES
If the queued publish/subscribe interface attempts to generate a response message in response to a non-persistent input message, and the response message cannot be delivered to the reply-to queue, this attribute indicates whether the interface tries to write the undeliverable message to the dead-letter queue or whether to discard the message.
PSRTYCNT
When the queued publish/subscribe interface fails to process a command message under sync point (for example a publish message that cannot be delivered to a subscriber because the subscriber queue is full and it is not possible to put the publication on the dead letter queue), the unit of work is backed out and the command tries this number of times again before the broker attempts to process the command message according to its report options instead.
PSSYNCPT
If this attribute is set to IFPER, when the queued publish/subscribe interface reads a publish or delete publication messages from a stream queue during normal operation then it specifies MQGMO_SYNCPOINT_IF_PERSISTENT. This value makes the queued pubsub daemon receive non-persistent messages outside sync point. If the daemon receives a publication outside sync point, the daemon forwards that publication to subscribers known to it outside sync point.
QMID
The internally generated unique name of the queue manager.
QMNAME
The name of the local queue manager. See Rules for naming IBM MQ objects.
[z/OS]QSGNAME
The name of the queue sharing group to which the queue manager belongs, or blank if the queue manager is not a member of a queue sharing group. You can use queue sharing groups only on z/OS.
[z/OS]RCVTIME
The approximate length of time that a TCP/IP channel waits to receive data, including heartbeats, from its partner before returning to an inactive state. The value of this parameter is the numeric value qualified by RCVTTYPE.

This parameter is valid only on z/OS.

[z/OS]RCVTMIN
The minimum length of time that a TCP/IP channel waits to receive data, including heartbeats, from its partner before returning to an inactive state.

This parameter is valid only on z/OS.

[z/OS]RCVTTYPE
The qualifier to apply to the value in RCVTIME.

This parameter is valid only on z/OS.

REMOTEEV
Whether remote error events are generated.
REPOS
The name of a cluster for which this queue manager is to provide a repository manager service.
REPOSNL
The name of a list of clusters for which this queue manager is to provide a repository manager service.
REVDNS
Whether reverse lookup of the host name from a Domain Name Server (DNS) is done for the IP address from which a channel has connected.
ROUTEREC
Whether trace-route information is to be recorded if requested in the message.
[UNIX, Linux, Windows, IBM i]SCHINIT
Whether the channel initiator is to be started automatically when the queue manager starts.

[z/OS]This parameter is not valid on z/OS.

[UNIX, Linux, Windows, IBM i]SCMDSERV
Whether the command server is to be started automatically when the queue manager starts.

[z/OS]This parameter is not valid on z/OS.

[z/OS]SCYCASE
Whether the security profiles are uppercase or mixed case.

This parameter is valid only on z/OS.

If this parameter has been altered but the REFRESH SECURITY command has not yet been issued, the queue manager might not be using the case of profiles you expect. Use DISPLAY SECURITY to verify which case of profiles is actually in use.

SPLCAP

Indicates if Advanced Message Security (AMS) capabilities are available to the queue manager. If the AMS component is installed for the version of IBM MQ that the queue manager is running under, the attribute has a value ENABLED. If the AMS component is not installed, the value is DISABLED.

[z/OS]SQQMNAME
When a queue manager makes an MQOPEN call for a shared queue and the queue manager that is specified in the ObjectQmgrName parameter of the MQOPEN call is in the same queue sharing group as the processing queue manager, the SQQMNAME attribute specifies whether the ObjectQmgrName is used or whether the processing queue manager opens the shared queue directly.

This parameter is valid only on z/OS.

SSLCRLNL
Indicates the namelist of AUTHINFO objects being used for the queue manager for certificate revocation checking.

Only authentication information objects with types of CRLLDAP or OCSP are allowed in the namelist referred to by SSLCRLNL. Any other type results in an error message when the list is processed and is subsequently ignored.

[AIX, Linux, Windows]SSLCRYP
Indicates the name of the parameter string being used to configure the cryptographic hardware present on the system. The PKCS #11 password appears as xxxxxx. This is valid only on AIX, Linux, and Windows.
SSLEV
Whether TLS events are generated.
SSLFIPS
Whether only FIPS certified algorithms are to be used if cryptography is processed in IBM MQ rather than in the cryptographic hardware itself.
SSLKEYR
Indicates the name of the Secure Sockets Layer key repository.
SSLRKEYC
Indicates the number of bytes to be sent and received within an TLS conversation before the secret key is renegotiated.
[z/OS]SSLTASKS
On z/OS only, indicates the number of server subtasks to use for processing TLS calls.
STATACLS
Whether statistics data is to be collected for auto-defined cluster-sender channels, and, if so, the rate of data collection.
STATCHL
It determines whether statistics data is to be collected for channels, and, if so, the rate of data collection.
[UNIX, Linux, Windows, IBM i]STATINT
The interval at which statistics monitoring data is written to the monitoring queue. This parameter is valid only on Multiplatforms.
[UNIX, Linux, Windows, IBM i]STATMQI
Whether statistics monitoring data is to be collected for the queue manager. This parameter is valid only on Multiplatforms.
STATQ
Whether statistics data is to be collected for queues.
STRSTPEV
Whether start and stop events are generated.
SUITEB
Whether Suite B compliant cryptography is used. For more information about Suite B configuration and its effect on TLS channels, see NSA Suite B Cryptography in IBM MQ .
SYNCPT
Whether sync point support is available with the queue manager. This is a read only queue manager attribute.
[z/OS]TCPCHL
The maximum number of channels that can be current, or clients that can be connected, that use the TCP/IP transmission protocol. If zero, the TCP/IP transmission protocol is not used.

This parameter is valid only on z/OS.

[z/OS]TCPKEEP
Whether the KEEPALIVE facility is to be used to check that the other end of the connection is still available. If it is unavailable, the channel is closed.

This parameter is valid only on z/OS.

[z/OS]TCPNAME
The name of the preferred TCP/IP stack to be used in a CINET multiple stack environment. In INET single stack environments the channel initiator uses the only available TCP/IP stack.

This parameter is valid only on z/OS.

[z/OS]TCPSTACK
Whether the channel initiator uses only the TCP/IP stack specified in TCPNAME, or can optionally bind to any of the TCP/IP stacks defined in a CINET multiple stack environment.

This parameter is valid only on z/OS.

[z/OS]TRAXSTR
Whether channel initiator trace starts automatically.

This parameter is valid only on z/OS.

[z/OS]TRAXTBL
The size, in megabytes, of the trace data space of the channel initiator.

This parameter is valid only on z/OS.

TREELIFE
The lifetime of non-administrative topics.
TRIGINT
The trigger interval.
VERSION
The version of the IBM MQ installation that the queue manager is associated with. The version has the format VVRRMMFF:
VV: Version
RR: Release
MM: Maintenance level
FF: Fix level
XRCAP
Whether MQ Telemetry capability is supported by the queue manager.
For more information about these parameters, see ALTER QMGR (alter queue manager settings).